PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00544.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 485aa    MW: 54562.2 Da    PI: 5.6884
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00544.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1578e-49281881128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...................................kv 51 
                              l+pGfrFhPtdeelv++yLk+kv gk++++ ++i +vdiyk+ePwdL                                     ++
  Rsa1.0_00544.1_g00004.1  28 LAPGFRFHPTDEELVSYYLKRKVMGKPVRF-DAIGDVDIYKHEPWDLAGnevcyslfgfefsvlsqdmkfvvaclteylkfvfsRL 112
                              579************************999.99**************84489***************************9999988 PP

                      NAM  52 kaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              k++++ewyf+s  dkky +g r nrat++gyWkatgkd+e+ + + +l g+kktLvf++grap+g +t+Wvmheyrl
  Rsa1.0_00544.1_g00004.1 113 KTRDQEWYFYSALDKKYGNGARMNRATNKGYWKATGKDREIRR-DIQLLGMKKTLVFHSGRAPDGLRTNWVMHEYRL 188
                              8899**************************************9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-182179IPR003441NAC domain
PROSITE profilePS5100552.81528212IPR003441NAC domain
PfamPF023656.2E-2630188IPR003441NAC domain
SuperFamilySSF1019414.58E-36111213IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MGRESVAVVS SPPTATPRGT TAVAGTSLAP GFRFHPTDEE LVSYYLKRKV MGKPVRFDAI  60
GDVDIYKHEP WDLAGNEVCY SLFGFEFSVL SQDMKFVVAC LTEYLKFVFS RLKTRDQEWY  120
FYSALDKKYG NGARMNRATN KGYWKATGKD REIRRDIQLL GMKKTLVFHS GRAPDGLRTN  180
WVMHEYRLVD YETESNGNLV QDAYVLCRVF HKNNIGPPSG NRYAPFLEEE WADDGVALIP  240
GVDVRVRAEP LPLANGNNQM DQSASKDLIN INEPPRETAP MDIELNHQNH HENAPKTQEN  300
NHYDEAEEAL KLEQAEEDER PPPPPVCVIN KEAPLPLLQY KRRRQNEPNN NSSRTTQDHC  360
SSTTTTVDNT PPTALISSSS AAAATNTAIS ALLEFSLMGI SAKKENQQQP PNKEASPPAP  420
LPSPEEKLND LQKEVHQMSV ERETFKLEMM SAEAMISILQ SRIDALRQEN DELRKNNNAK  480
GQAVL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D7e-432021412170NAC domain-containing protein 19
3swp_C7e-432021412170NAC domain-containing protein 19
3swp_B7e-432021412170NAC domain-containing protein 19
3swp_A7e-432021412170NAC domain-containing protein 19
3swm_D7e-432021412170NAC domain-containing protein 19
3swm_C7e-432021412170NAC domain-containing protein 19
3swm_B7e-432021412170NAC domain-containing protein 19
3swm_A7e-432021412170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00612ChIP-seqTransfer from AT3G10490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013750306.10.0PREDICTED: NAC domain-containing protein 78-like isoform X3
TrEMBLA0A078F5F00.0A0A078F5F0_BRANA; BnaA05g28370D protein
STRINGBra029844.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17802880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.10.0NAC domain containing protein 50